TA334933 CENP-P antibody

Rabbit Polyclonal Anti-CENPP Antibody

See related secondary antibodies

Search for all "CENP-P"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Equine, Human CENP-P

Product Description for CENP-P

Rabbit anti Equine, Human CENP-P.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CENP-P

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CENPP, Centromere protein P
Presentation Purified
Reactivity Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IPU0
Immunogen:
The immunogen for anti-CENPP antibody: synthetic peptide directed towards the N terminal of human CENPP. Synthetic peptide located within the following region: VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ.
GeneID:
401541
Application WB
Background CENPP is the component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. CENPP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-C complex.CENPP is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1104 CR592049.1 1-1104 1105-1633 BC071726.1 622-1150 1634-1689 BX537851.1 972-1027 1690-3411 AK091247.1 839-2560 3412-3428 AL833701.1 3078-3094
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CENP-P (3 products)

Catalog No. Species Pres. Purity   Source  

CENP-P

CENP-P Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

CENP-P (1-288, His-tag)

CENP-P Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

CENP-P (1-288, His-tag)

CENP-P Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

Positive controls for CENP-P (1 products)

Catalog No. Species Pres. Purity   Source  

CENPP overexpression lysate

CENPP overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn