TA334846 C17orf89 antibody

Rabbit Polyclonal Anti-C17orf89 Antibody

See related secondary antibodies

Search for all "C17orf89"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat C17orf89

Product Description for C17orf89

Rabbit anti Canine, Human, Mouse, Rat C17orf89.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C17orf89

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A1L188
Immunogen:
The immunogen for anti-C17orf89 antibody is: synthetic peptide directed towards the N-terminal region of Human C17orf89. Synthetic peptide located within the following region: VWGRVRSRLRAFPERLAACGAEAAAYGRCVQASTAPGGRLSKDFCAREFE.
GeneID:
284184
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C17orf89 (1 products)

Catalog No. Species Pres. Purity   Source  

C17orf89 overexpression lysate

C17orf89 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn