TA334840 SIAH3 antibody

Rabbit Polyclonal Anti-SIAH3 Antibody

See related secondary antibodies

Search for all "SIAH3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Human, Rabbit SIAH3

Product Description for SIAH3

Rabbit anti Canine, Equine, Human, Rabbit SIAH3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SIAH3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Seven in absentia homolog 3
Presentation Purified
Reactivity Can, Eq, Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IW03
Immunogen:
The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA.
GeneID:
283514
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SIAH3 (1 products)

Catalog No. Species Pres. Purity   Source  

SIAH3 overexpression lysate

SIAH3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn