TA334732 RGS13 antibody

Rabbit Polyclonal Anti-RGS13 Antibody

See related secondary antibodies

Search for all "RGS13"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat RGS13

TA334732

More Views

  • TA334732

Product Description for RGS13

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat RGS13.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for RGS13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Regulator of G-protein signaling 13
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O14921
Immunogen:
The immunogen for anti-RGS13 antibody: synthetic peptide directed towards the middle region of human RGS13. Synthetic peptide located within the following region: WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK.
GeneID:
6003
Application WB
IHC
Background RGS13 encodes a protein which is a member of the regulator of G protein sigling (RGS) family. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their ictive GDP-bound form, thus negatively regulating G protein sigling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RGS13 (1 products)

Catalog No. Species Pres. Purity   Source  

RGS13 (transcript variant 2)

RGS13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn