TA334669 BAL / CEL antibody

Rabbit Polyclonal Anti-CEL Antibody

See related secondary antibodies

Search for all "BAL / CEL"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Equine, Human, Mouse, Porcine, Rat BAL / CEL

Product Description for BAL / CEL

Rabbit anti Equine, Human, Mouse, Porcine, Rat BAL / CEL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BAL / CEL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BSDL, BSSL, Bile salt-activated lipase, Bile salt-stimulated lipase, Bucelipase, CELL, CEase, Carboxyl ester lipase, Cholesterol esterase, FAP, FAPP, LIPA, MODY8, Pancreatic lysophospholipase, Sterol esterase
Presentation Purified
Reactivity Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P19835
Immunogen:
The immunogen for anti-CEL antibody: synthetic peptide directed towards the middle region of human CEL. Synthetic peptide located within the following region: VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR.
GeneID:
1056
Application WB
Background CEL catalyzes fat and vitamin absorption. CEL acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides.The protein encoded by this gene is a glycoprotein secreted from the pancreas into the digestive tract and from the lactating mammary gland into human milk. The physiological role of this protein is in cholesterol and lipid-soluble vitamin ester hydrolysis and absorption. This encoded protein promotes large chylomicron production in the intestine. Also its presence in plasma suggests its interactions with cholesterol and oxidized lipoproteins to modulate the progression of atherosclerosis. In pancreatic tumoral cells, this encoded protein is thought to be sequestrated within the Golgi compartment and is probably not secreted. This gene contains a variable number of tandem repeat (VNTR) polymorphism in the coding region that may influence the function of the encoded protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn