TA334627 SLC6A15 / NTT73 antibody

Rabbit Polyclonal Anti-Slc6a15 Antibody

See related secondary antibodies

Search for all "SLC6A15 / NTT73"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat, Zebrafish SLC6A15 / NTT73

Product Description for SLC6A15 / NTT73

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat, Zebrafish SLC6A15 / NTT73.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC6A15 / NTT73

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, Orphan transporter v7-3, Solute carrier family 6 member 15
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2J7
Immunogen:
The immunogen for anti-Slc6a15 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VEDYRLVYDIIQKVKEEEFAVLHLNACQIEDELNKAVQGTGLAFIAFTEA.
GeneID:
55117
Application WB
Background Slc6a15 functions as a sodium-dependent neutral amino acid transporter. It exhibits preference for methionine and for the branched-chain amino acids, particulary leucine, valine and isoleucine. It mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. Slc6a15 may have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, Slc6a15 does not appear to be chloride-dependent.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLC6A15 / NTT73 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC6A15 overexpression lysate

SLC6A15 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn