TA334559 Vasohibin-1 / VASH1 antibody

Rabbit Polyclonal Anti-VASH1 Antibody

See related secondary antibodies

Search for all "Vasohibin-1 / VASH1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat Vasohibin-1 / VASH1

Product Description for Vasohibin-1 / VASH1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat Vasohibin-1 / VASH1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Vasohibin-1 / VASH1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1036, VASH
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7L8A9
Immunogen:
The immunogen for anti-VASH1 antibody: synthetic peptide directed towards the N terminal of human VASH1. Synthetic peptide located within the following region: ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER.
GeneID:
22846
Application WB
Background VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Vasohibin-1 / VASH1 (1 products)

Catalog No. Species Pres. Purity   Source  

Vasohibin-1 / VASH1

Vasohibin-1 / VASH1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for Vasohibin-1 / VASH1 (1 products)

Catalog No. Species Pres. Purity   Source  

VASH1 overexpression lysate

VASH1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn