TA334538 Sestrin-1 (SESN1) antibody

Rabbit Polyclonal Anti-SESN1 Antibody

See related secondary antibodies

Search for all "Sestrin-1 (SESN1)"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat Sestrin-1 (SESN1)

Product Description for Sestrin-1 (SESN1)

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat Sestrin-1 (SESN1).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Sestrin-1 (SESN1)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PA26, SEST1, Sestrin 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y6P5
Immunogen:
The immunogen for anti-SESN1 antibody is: synthetic peptide directed towards the middle region of Human SESN1. Synthetic peptide located within the following region: KWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAE.
GeneID:
27244
Application WB
Background This gene encodes a member of the sestrin family. Sestrins are induced by the p53 tumor suppressor protein and play a role in the cellular response to D damage and oxidative stress. The encoded protein mediates p53 inhibition of cell growth by activating AMP-activated protein kise, which results in the inhibition of the mammalian target of rapamycin protein. The encoded protein also plays a critical role in antioxidant defense by regenerating overoxidized peroxiredoxins, and the expression of this gene is a potential marker for exposure to radiation. Altertively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn