TA334532 Dickkopf-1 antibody

Rabbit Polyclonal Anti-DKK1 Antibody

See related secondary antibodies

Search for all "Dickkopf-1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat, Zebrafish Dickkopf-1

Product Description for Dickkopf-1

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat, Zebrafish Dickkopf-1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Dickkopf-1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DKK-1, DKK1, Dickkopf-related protein 1, SK
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O94907
Immunogen:
The immunogen for anti-DKK1 antibody is: synthetic peptide directed towards the C-terminal region of Human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD.
GeneID:
22943
Application WB
Background DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT sigling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Dickkopf-1 (8 products)

Catalog No. Species Pres. Purity   Source  

Dickkopf-1 (full length, C-term DDK tag)

Dickkopf-1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / $411.00
  OriGene Technologies, Inc.

Dickkopf-1

Dickkopf-1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / $230.00
  OriGene Technologies, Inc.

Dickkopf-1 (32-266, His-tag)

Dickkopf-1 Human Purified > 85 % by SDS - PAGE High-5 Insect cells
50 µg / $1,400.00
  OriGene Technologies GmbH

Dickkopf-1 (32-266, His-tag)

Dickkopf-1 Human Purified > 85 % by SDS - PAGE High-5 Insect cells
10 µg / $370.00
  OriGene Technologies GmbH

Dickkopf-1

Dickkopf-1 Human Purified > 97 % pure by SDS-PAGE and HPLC analyses. HEK293 cells
  OriGene Technologies GmbH

Dickkopf-1

Dickkopf-1 Human Purified > 97 % pure by SDS-PAGE and HPLC analyses. HEK293 cells
  OriGene Technologies GmbH

Dickkopf-1 (32-266, His-tag)

Dickkopf-1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

Dickkopf-1 (32-266, His-tag)

Dickkopf-1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH
  • LinkedIn