TA334324 MBOAT4 / OACT4 antibody

Rabbit Polyclonal Anti-MBOAT4 Antibody

See related secondary antibodies

Search for all "MBOAT4 / OACT4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Sheep MBOAT4 / OACT4

Product Description for MBOAT4 / OACT4

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Sheep MBOAT4 / OACT4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MBOAT4 / OACT4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GOAT, Ghrelin O-acyltransferase, Membrane-bound O-acyltransferase domain-containing protein 4, O-acyltransferase domain-containing protein 4
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96T53
Immunogen:
The immunogen for anti-MBOAT4 antibody is: synthetic peptide directed towards the C-terminal region of Human MBOAT4. Synthetic peptide located within the following region: FKLTYYSHWILDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRIS.
GeneID:
619373
Application WB
Background MBOAT4 mediates the octanoylation of ghrelin at 'Ser-3'. It can use a variety of fatty acids as substrates including octanoic acid, decanoic acid and tetradecanoic acid.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for MBOAT4 / OACT4 (1 products)

Catalog No. Species Pres. Purity   Source  

MBOAT4 overexpression lysate

MBOAT4 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn