TA334232 KNTC1 antibody

Rabbit Polyclonal Anti-KNTC1 Antibody

See related secondary antibodies

Search for all "KNTC1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat KNTC1

Product Description for KNTC1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat KNTC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KNTC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HsROD, KIAA0166, KNTC1, Kinetochore-associated protein 1, Rod, Rough deal homolog, hRod
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P50748
Immunogen:
The immunogen for anti-KNTC1 antibody: synthetic peptide directed towards the N terminal of human KNTC1. Synthetic peptide located within the following region: MWNDIELLTNDDTGSGYLSVGSRKEHGTALYQVDLLVKISSEKASLNPKI.
GeneID:
9735
Application WB
Background This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn