TA334133 FAM220A antibody

Rabbit Polyclonal Anti-FAM220A Antibody

See related secondary antibodies

Search for all "FAM220A"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human FAM220A

Product Description for FAM220A

Rabbit anti Human FAM220A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM220A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C7orf70, SIPAR, STAT3-interacting protein as a repressor
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z4H9
Immunogen:
The immunogen for Anti-FAM220A Antibody is: synthetic peptide directed towards the middle region of Human FAM220A. Synthetic peptide located within the following region: ATPSTAVGLFPAPTECFARVSCSGVEALGRRDWLGGGPRATDGHRGQCPK.
GeneID:
84792
Application WB
Background FAM220A may negatively regulate STAT3.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM220A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM220A overexpression lysate

FAM220A overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn