TA334124 C9orf116 antibody

Rabbit Polyclonal Anti-C9orf116 Antibody

See related secondary antibodies

Search for all "C9orf116"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish C9orf116

Product Description for C9orf116

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish C9orf116.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C9orf116

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pierce1, UPF0691 protein C9orf116, p53-induced expression in RB-null cells protein 1
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5BN46
Immunogen:
The immunogen for Anti-C9orf116 Antibody is: synthetic peptide directed towards the N-terminal region of Human C9orf116. Synthetic peptide located within the following region: NNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQL.
GeneID:
138162
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C9orf116 (1 products)

Catalog No. Species Pres. Purity   Source  

C9orf116 overexpression lysate

C9orf116 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn