TA334048 SLC7A1 / CAT1 antibody

Rabbit Polyclonal Anti-SLC7A1 Antibody

See related secondary antibodies

Search for all "SLC7A1 / CAT1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit SLC7A1 / CAT1

Product Description for SLC7A1 / CAT1

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit SLC7A1 / CAT1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC7A1 / CAT1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATRC1, CAT-1, ERR, Ecotropic retroviral leukemia receptor homolog, Ecotropic retrovirus receptor homolog, High affinity cationic amino acid transporter 1, REC1L, Solute carrier family 7 member 1, System Y+ basic amino acid transporter
Presentation Purified
Reactivity Bov, Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P30825
Immunogen:
The immunogen for Anti-SLC7A1 Antibody: synthetic peptide directed towards the N terminal of human SLC7A1. Synthetic peptide located within the following region: LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF.
GeneID:
6541
Application WB
Background SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC7A1 / CAT1 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC7A1 / CAT1

SLC7A1 / CAT1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn