TA334028 TAF4 antibody

Rabbit Polyclonal Anti-TAF4 Antibody

See related secondary antibodies

Search for all "TAF4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit TAF4

TA334028

More Views

  • TA334028

Product Description for TAF4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit TAF4.
Presentation: Purified
Product is tested for ChIP assay, Western blot / Immunoblot.

Properties for TAF4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RNA polymerase II TBP-associated factor subunit C, TAF(II)130, TAF(II)135, TAF2C, TAF2C1, TAF4A, TAFII-130, TAFII-135, TAFII130, TAFII135, TBP-associated factor 4, Transcription initiation factor TFIID 130 kDa subunit, Transcription initiation factor TFIID 135 kDa subunit, Transcription initiation factor TFIID subunit 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb
Applications ChIP, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00268
Immunogen:
The immunogen for Anti-TAF4 Antibody: synthetic peptide directed towards the middle region of human TAF4. Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL.
GeneID:
6874
Application WB
Chip
Background Initiation of transcription by R polymerase II requires the activities of more than 70 polypeptides. The protein that coordites these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory sigls. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutiorily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF4 is one of the larger subunits of TFIID that has been shown to potentiate transcriptiol activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases.Initiation of transcription by R polymerase II requires the activities of more than 70 polypeptides. The protein that coordites these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory sigls. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutiorily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the larger subunits of TFIID that has been shown to potentiate transcriptiol activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn