TA333920 Collectin-10 antibody

Rabbit Polyclonal Anti-COLEC10 Antibody

See related secondary antibodies

Search for all "Collectin-10"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Collectin-10

Product Description for Collectin-10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Collectin-10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Collectin-10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CL-34, CL-L1, CLL1, COLEC10, Collectin liver protein 1, Collectin-34
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y6Z7
Immunogen:
The immunogen for Anti-COLEC10 Antibody is: synthetic peptide directed towards the N-terminal region of Human COLEC10. Synthetic peptide located within the following region: IKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCDCGRY.
GeneID:
10584
Application WB
Background This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. The other members of this family are secreted proteins and bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. This gene product is a cytosolic protein, a characteristic that suggests that it may have different biological functions than other C-lectins.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn