TA333809 Ankycorbin / RAI14 antibody

Rabbit Polyclonal Anti-RAI14 Antibody

See related secondary antibodies

Search for all "Ankycorbin / RAI14"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Ankycorbin / RAI14

Product Description for Ankycorbin / RAI14

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Ankycorbin / RAI14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Ankycorbin / RAI14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ankyrin repeat and coiled-coil structure-containing protein, KIAA1334, NORPEG, Novel retinal pigment epithelial cell protein, Retinoic acid-induced protein 14
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P0K7
Immunogen:
The immunogen for Anti-RAI14 Antibody: synthetic peptide directed towards the middle region of human RAI14. Synthetic peptide located within the following region: LSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAED.
GeneID:
26064
Application WB
Background RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Ankycorbin / RAI14 (2 products)

Catalog No. Species Pres. Purity   Source  

Ankycorbin / RAI14 (transcript variant 1)

Ankycorbin / RAI14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

Ankycorbin / RAI14 (transcript variant 2)

Ankycorbin / RAI14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

Positive controls for Ankycorbin / RAI14 (1 products)

Catalog No. Species Pres. Purity   Source  

RAI14 overexpression lysate

RAI14 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn