TA333765 SLC25A38 antibody

Rabbit Polyclonal Anti-SLC25A38 Antibody

See related secondary antibodies

Search for all "SLC25A38"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human SLC25A38

TA333765

More Views

  • TA333765

Product Description for SLC25A38

Rabbit anti Human SLC25A38.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SLC25A38

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Solute carrier family 25 member 38
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96DW6
Immunogen:
The immunogen for Anti-SLC25A38 Antibody: synthetic peptide directed towards the middle region of human SLC25A38. Synthetic peptide located within the following region: VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR.
GeneID:
54977
Application WB
IHC
Background SLC25A38 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC25A38 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC25A38 (full length, N-term HIS tag)

SLC25A38 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.
  • LinkedIn