TA333722 TSPYL4 antibody

Rabbit Polyclonal Anti-TSPYL4 Antibody

See related secondary antibodies

Search for all "TSPYL4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TSPYL4

Product Description for TSPYL4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TSPYL4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TSPYL4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TSPY-like protein 4, Testis-specific Y-encoded-like protein 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UJ04
Immunogen:
The immunogen for Anti-TSPYL4 Antibody: synthetic peptide directed towards the middle region of human TSPYL4. Synthetic peptide located within the following region: QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE.
GeneID:
23270
Application WB
Background TSPYL4 belongs to the nucleosome assembly protein (P) family. The functions of TSPYL4 remain unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TSPYL4 (1 products)

Catalog No. Species Pres. Purity   Source  

TSPYL4

TSPYL4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn