TA333662 CBLL1 / RNF188 antibody

Rabbit Polyclonal Anti-CBLL1 Antibody

See related secondary antibodies

Search for all "CBLL1 / RNF188"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CBLL1 / RNF188

Product Description for CBLL1 / RNF188

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CBLL1 / RNF188.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CBLL1 / RNF188

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Casitas B-lineage lymphoma-transforming sequence-like protein 1, E3 ubiquitin-protein ligase Hakai, HAKAI, RING finger protein 188, c-Cbl-like protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q75N03
Immunogen:
The immunogen for Anti-CBLL1 Antibody: synthetic peptide directed towards the N terminal of human CBLL1. Synthetic peptide located within the following region: MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINR.
GeneID:
79872
Application WB
Background Epithelial cell cadherin is endocytosed as a consequence of tyrosine phosphorylation and ubiquitition. CBLL1 is an E3 ubiquitin ligase that mediates ubiquitition of the CDH1 complex.Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitition. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitition of the CDH1 complex.Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitition. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitition of the CDH1 complex.[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CBLL1 / RNF188 (1 products)

Catalog No. Species Pres. Purity   Source  

CBLL1 overexpression lysate

CBLL1 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn