TA333641 SLC25A32 antibody

Rabbit Polyclonal Anti-SLC25A32 Antibody

See related secondary antibodies

Search for all "SLC25A32"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human SLC25A32

Product Description for SLC25A32

Rabbit anti Human SLC25A32.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC25A32

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MFT, MFTC, Mitochondrial folate transporter/carrier, Solute carrier family 25 member 32
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2D1
Immunogen:
The immunogen for Anti-SLC25A32 Antibody: synthetic peptide directed towards the middle region of human SLC25A32. Synthetic peptide located within the following region: NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID.
GeneID:
81034
Application WB
Background SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria (Titus and Moran, 2000 [PubMed 10978331]).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn