TA333598 FAM222A antibody

Rabbit Polyclonal Anti-FAM222A Antibody

See related secondary antibodies

Search for all "FAM222A"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FAM222A

Product Description for FAM222A

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FAM222A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM222A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C12orf34
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5U5X8
Immunogen:
The immunogen for Anti-FAM222A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM222A. Synthetic peptide located within the following region: PQHTAGYQGLLAIVKAAVSSSSTAAPAGPAKSVLKSAEGKRTKLSPAAVQ.
GeneID:
84915
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn