TA333528 ALKBH3 / DEPC1 antibody

Rabbit Polyclonal Anti-ALKBH3 Antibody

See related secondary antibodies

Search for all "ALKBH3 / DEPC1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ALKBH3 / DEPC1

Product Description for ALKBH3 / DEPC1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ALKBH3 / DEPC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ALKBH3 / DEPC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ABH3, Alkylated DNA repair protein alkB homolog 3, Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3, Prostate cancer antigen 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96Q83
Immunogen:
The immunogen for Anti-ALKBH3 Antibody: synthetic peptide directed towards the middle region of human ALKBH3. Synthetic peptide located within the following region: EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS.
GeneID:
221120
Application WB
Background The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific D lesions generated in single-stranded D. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific D lesions generated in single-stranded D. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1519 AB042029.1 2-1520
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ALKBH3 / DEPC1 (3 products)

Catalog No. Species Pres. Purity   Source  

ALKBH3 / DEPC1

ALKBH3 / DEPC1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

ALKBH3 / DEPC1 (1-286, His-tag)

ALKBH3 / DEPC1 Human Purified > 95 % E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

ALKBH3 / DEPC1 (1-286, His-tag)

ALKBH3 / DEPC1 Human Purified > 95 % E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH
  • LinkedIn