TA333439 CASC4 antibody

Rabbit Polyclonal Anti-CASC4 Antibody

See related secondary antibodies

Search for all "CASC4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Mouse CASC4

Product Description for CASC4

Rabbit anti Human, Mouse CASC4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CASC4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cancer susceptibility candidate gene 4 protein
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P4E1
Immunogen:
The immunogen for Anti-CASC4 Antibody is: synthetic peptide directed towards the middle region of Human CASC4. Synthetic peptide located within the following region: FQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQV.
GeneID:
113201
Application WB
Background The increased expression level of this gene is associated with HER-2/neu proto-oncogene overexpression. Amplification and resulting overexpression of this proto-oncogene are found in approximately 30% of human breast and 20% of human ovarian cancers. Altertively spliced variants encoding different isoforms have been identified for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CASC4 (1 products)

Catalog No. Species Pres. Purity   Source  

CASC4 overexpression lysate

CASC4 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn