TA333385 SLC7A8 / LAT2 antibody

Rabbit Polyclonal Anti-SLC7A8 Antibody

See related secondary antibodies

Search for all "SLC7A8 / LAT2"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLC7A8 / LAT2

Product Description for SLC7A8 / LAT2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLC7A8 / LAT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC7A8 / LAT2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms L-type amino acid transporter 2, Large neutral amino acids transporter small subunit 2, Solute carrier family 7 member 8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UHI5
Immunogen:
The immunogen for Anti-SLC7A8 Antibody: synthetic peptide directed towards the middle region of human SLC7A8. Synthetic peptide located within the following region: PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA.
GeneID:
23428
Application WB
Background SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral amino acids.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLC7A8 / LAT2 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC7A8 overexpression lysate

SLC7A8 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn