TA333336 PRR19 antibody

Rabbit Polyclonal Anti-MGC70924 Antibody

See related secondary antibodies

Search for all "PRR19"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human PRR19

Product Description for PRR19

Rabbit anti Human PRR19.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRR19

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MGC70924, Proline-rich protein 19
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NJB7
Immunogen:
The immunogen for Anti-MGC70924 Antibody: synthetic peptide directed towards the N terminal of human MGC70924. Synthetic peptide located within the following region: MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIR.
GeneID:
284338
Application WB
Background The specific function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for PRR19 (1 products)

Catalog No. Species Pres. Purity   Source  

PRR19 overexpression lysate

PRR19 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn