TA333320 LRRN4CL antibody

Rabbit Polyclonal Anti-LRRN4CL Antibody

See related secondary antibodies

Search for all "LRRN4CL"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Equine, Human, Rat LRRN4CL

Product Description for LRRN4CL

Rabbit anti Equine, Human, Rat LRRN4CL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LRRN4CL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LRRN4 C-terminal-like protein
Presentation Purified
Reactivity Eq, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8ND94
Immunogen:
The immunogen for Anti-LRRN4CL Antibody: synthetic peptide directed towards the middle region of human LOC221091. Synthetic peptide located within the following region: PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA.
GeneID:
221091
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRN4CL (1 products)

Catalog No. Species Pres. Purity   Source  

LRRN4CL

LRRN4CL Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for LRRN4CL (1 products)

Catalog No. Species Pres. Purity   Source  

LRRN4CL overexpression lysate

LRRN4CL overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn