TA333313 SPINK6 antibody

Rabbit Polyclonal Anti-SPINK6 Antibody

See related secondary antibodies

Search for all "SPINK6"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Equine, Human, Porcine SPINK6

Product Description for SPINK6

Rabbit anti Equine, Human, Porcine SPINK6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPINK6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Serine protease inhibitor Kazal-type 6
Presentation Purified
Reactivity Eq, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UWN8
Immunogen:
The immunogen for Anti-SPINK6 Antibody: synthetic peptide directed towards the middle region of human SPINK6. Synthetic peptide located within the following region: GEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC.
GeneID:
404203
Application WB
Background The protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SPINK6 (1 products)

Catalog No. Species Pres. Purity   Source  

SPINK6 overexpression lysate

SPINK6 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn