TA332307 OR51M1 antibody

Rabbit Polyclonal Anti-OR51M1 Antibody

See related secondary antibodies

Search for all "OR51M1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Human, Mouse, Rabbit OR51M1

Product Description for OR51M1

Rabbit anti Canine, Human, Mouse, Rabbit OR51M1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OR51M1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Odorant receptor HOR5'beta7, Olfactory receptor 51M1, Olfactory receptor OR11-40
Presentation Purified
Reactivity Can, Hu, Ms, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H341
Immunogen:
The immunogen for Anti-OR51M1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR51M1. Synthetic peptide located within the following region: LYGLMVVVFTVMLDLVLIALSYGLILHTVAGLASQEEQRRAFQTCTAHRC.
GeneID:
390059
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn