TA332277 FBXO47 antibody

Rabbit Polyclonal Anti-FBXO47 Antibody

See related secondary antibodies

Search for all "FBXO47"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Yeast FBXO47

Product Description for FBXO47

Rabbit anti Human, Yeast FBXO47.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FBXO47

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms F-box only protein 47
Presentation Purified
Reactivity Hu, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5MNV8
Immunogen:
The immunogen for Anti-FBXO47 Antibody is: synthetic peptide directed towards the N-terminal region of Human FBXO47. Synthetic peptide located within the following region: ASRINTNFTLIPNQKLRRSNRQTSCYSKTLGSGFQPISTFGNFKALPLEI.
GeneID:
494188
Application WB
Background FBXO47 probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitition and degradation.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn