TA332276 Speedy C / RINGO C antibody

Rabbit Polyclonal Anti-SPDYC Antibody

See related secondary antibodies

Search for all "Speedy C / RINGO C"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human Speedy C / RINGO C

Product Description for Speedy C / RINGO C

Rabbit anti Human Speedy C / RINGO C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Speedy C / RINGO C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Rapid inducer of G2/M progression in oocytes C, Ringo, SPDYC, Speedy protein C
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5MJ68
Immunogen:
The immunogen for Anti-SPDYC Antibody is: synthetic peptide directed towards the N-terminal region of Human SPDYC. Synthetic peptide located within the following region: PISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAF.
GeneID:
387778
Application WB
Background SPDYC promotes progression through the cell cycle via binding and activation of CDK1 and CDK2. It is involved in the spindle-assembly checkpoint. It is required for recruitment of MAD2L1, BUBR1 and BUB1 to kinetochores and is required for the correct localization of the active form of Aurora B in prometaphase.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Speedy C / RINGO C (1 products)

Catalog No. Species Pres. Purity   Source  

SPDYC overexpression lysate

SPDYC overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn