TA332230 CEP85L antibody

Rabbit Polyclonal Anti-CEP85L Antibody

See related secondary antibodies

Search for all "CEP85L"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit CEP85L

Product Description for CEP85L

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit CEP85L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CEP85L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6orf204, Centrosomal protein of 85 kDa-like, Serologically defined breast cancer antigen NY-BR-15
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5SZL2
Immunogen:
The immunogen for Anti-CEP85L Antibody is: synthetic peptide directed towards the N-terminal region of Human CEP85L. Synthetic peptide located within the following region: KAKALTSQLRTIGPSCLHDSMEMLRLEDKEINKKRSSTLDCKYKFESCSK.
GeneID:
387119
Application WB
Background The protein encoded by this gene was identified as a breast cancer antigen. Nothing more is known of its function at this time. Three transcript variants encoding different isoforms have been found for this gene.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn