TA332195 TDRD12 antibody

Rabbit Polyclonal Anti-TDRD12 Antibody

See related secondary antibodies

Search for all "TDRD12"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Human, Porcine TDRD12

Product Description for TDRD12

Rabbit anti Bovine, Equine, Human, Porcine TDRD12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TDRD12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ECAT8, ES cell-associated transcript 8 protein, Putative ATP-dependent RNA helicase TDRD12, Tudor domain-containing protein 12
Presentation Purified
Reactivity Bov, Eq, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q587J7
Immunogen:
The immunogen for Anti-TDRD12 Antibody is: synthetic peptide directed towards the C-terminal region of Human TDRD12. Synthetic peptide located within the following region: DKAVKCNMDSLRDSPKDKSEKKHHCISLKDTNKRVESSVYWPAKRGITIY.
GeneID:
91646
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TDRD12 (1 products)

Catalog No. Species Pres. Purity   Source  

TDRD12 overexpression lysate

TDRD12 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn