TA332170 FBXW12 antibody

Rabbit Polyclonal Anti-FBXW12 Antibody

See related secondary antibodies

Search for all "FBXW12"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human FBXW12

Product Description for FBXW12

Rabbit anti Human FBXW12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FBXW12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms F-box and WD-40 domain-containing protein 12, F-box only protein 35, F-box/WD repeat-containing protein 12, FBW12, FBXO12, FBXO35
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6X9E4
Immunogen:
The immunogen for Anti-FBXW12 Antibody is: synthetic peptide directed towards the C-terminal region of Human FBXW12. Synthetic peptide located within the following region: CASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIA.
GeneID:
285231
Application WB
Background Members of the F-box protein family, such as FBXW12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitition targets through other protein interaction domains.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for FBXW12 (1 products)

Catalog No. Species Pres. Purity   Source  

FBXW12 overexpression lysate

FBXW12 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn