TA332130 GOT2 antibody

Rabbit Polyclonal Anti-GOT2 Antibody

See related secondary antibodies

Search for all "GOT2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish GOT2

Product Description for GOT2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish GOT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GOT2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Aspartate aminotransferase, FABP-1, FABPpm, Fatty acid-binding protein, Transaminase A, mAspAT, mitochondrial
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P00505
Immunogen:
The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA.
GeneID:
2806
Application WB
Background Glutamic-oxaloacetic transamise is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transamise is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GOT2 (2 products)

Catalog No. Species Pres. Purity   Source  

GOT2 (30-430, His-tag)

GOT2 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

GOT2 (30-430, His-tag)

GOT2 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH
  • LinkedIn