TA332097 CDKL1 antibody

Rabbit Polyclonal Anti-CDKL1 Antibody

See related secondary antibodies

Search for all "CDKL1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CDKL1

Product Description for CDKL1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CDKL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CDKL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cyclin-dependent kinase-like 1, KKIALRE, Protein kinase p42 KKIALRE, Serine/threonine-protein kinase KKIALRE
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q00532
Immunogen:
The immunogen for Anti-CDKL1 Antibody is: synthetic peptide directed towards the N-terminal region of Human CDKL1. Synthetic peptide located within the following region: EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALRE.
GeneID:
8814
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CDKL1 (1 products)

Catalog No. Species Pres. Purity   Source  

CDKL1 overexpression lysate

CDKL1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn