TA331797 GATAD1 / ODAG antibody

Rabbit Polyclonal Anti-GATAD1 Antibody

See related secondary antibodies

Search for all "GATAD1 / ODAG"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish, African clawed frog GATAD1 / ODAG

Product Description for GATAD1 / ODAG

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish, African clawed frog GATAD1 / ODAG.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for GATAD1 / ODAG

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GATA zinc finger domain-containing protein 1, Ocular development-associated gene protein
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WUU5
Immunogen:
The immunogen for anti-GATAD1 antibody: synthetic peptide directed towards the C terminal of human GATAD1.
AA Sequence:
KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKES
GeneID:
57798
Application Western blotting (0.2 - 1.0 µg/ml)
Background ODAG (Ocular development-associated gene) also called GATAD1, a novel transcription factor located on chromosome 7, encodes a protein that may play a role in eye development. mRNA profiling in multiple human tissue indicates that ODAG is expressed in human CD56+ NK cells and thyroid tissue.
General Readings Tsuruga,T., et al., (2002) Gene 290 (1-2), 125-130
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Bovine, African clawed frog, Zebrafish
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for GATAD1 / ODAG (1 products)

Catalog No. Species Pres. Purity   Source  

GATAD1 / ODAG (full length, N-term HIS tag)

GATAD1 / ODAG Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for GATAD1 / ODAG (1 products)

Catalog No. Species Pres. Purity   Source  

GATAD1 overexpression lysate

GATAD1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn