TA331764 PRAMEF1 antibody

Rabbit Polyclonal Anti-PRAMEF1 Antibody

See related secondary antibodies

Search for all "PRAMEF1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human PRAMEF1

Product Description for PRAMEF1

Rabbit anti Human PRAMEF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRAMEF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PRAME family member 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95521
Immunogen:
The immunogen for Anti-PRAMEF1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PRAMEF1. Synthetic peptide located within the following region: GAWALSCFPETTSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYL.
GeneID:
65121
Application WB
Background This gene is a member of the PRAME (preferentially expressed antigen of melanoma) gene family which is expressed in many cancers but may function in reproductive tissues during development.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn