TA331741 DHX40 antibody

Rabbit Polyclonal Anti-DHX40 Antibody

See related secondary antibodies

Search for all "DHX40"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat DHX40

Product Description for DHX40

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat DHX40.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DHX40

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARG147, DDX40, DEAH box protein 40, Probable ATP-dependent RNA helicase DHX40, Protein PAD
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IX18
Immunogen:
The immunogen for Anti-DHX40 Antibody is: synthetic peptide directed towards the N-terminal region of Human DHX40. Synthetic peptide located within the following region: RRQEEGERSRDLQEERLSAVCIADREEKGCTSQEGGTTPTFPIQKQRKKI.
GeneID:
79665
Application WB
Background This gene encodes a member of the DExH/D box family of ATP-dependent R helicases that have an essential role in R metabolism. Alterte splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 17.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DHX40 (1 products)

Catalog No. Species Pres. Purity   Source  

DHX40

DHX40 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for DHX40 (1 products)

Catalog No. Species Pres. Purity   Source  

DHX40 overexpression lysate

DHX40 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn