TA331725 GPR157 antibody

Rabbit Polyclonal Anti-GPR157 Antibody

See related secondary antibodies

Search for all "GPR157"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human GPR157

Product Description for GPR157

Rabbit anti Human GPR157.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GPR157

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-protein coupled receptor 157
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5UAW9
Immunogen:
The immunogen for Anti-GPR157 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR157. Synthetic peptide located within the following region: VRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST.
GeneID:
80045
Application WB
Background GPR157 is a orphan receptor.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for GPR157 (1 products)

Catalog No. Species Pres. Purity   Source  

GPR157 overexpression lysate

GPR157 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn