TA331676 MAS1L / MRG antibody

Rabbit Polyclonal Anti-MAS1L Antibody

See related secondary antibodies

Search for all "MAS1L / MRG"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human MAS1L / MRG

Product Description for MAS1L / MRG

Rabbit anti Human MAS1L / MRG.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MAS1L / MRG

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Mas-related G-protein coupled receptor MRG
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35410
Immunogen:
The immunogen for Anti-MAS1L Antibody is: synthetic peptide directed towards the N-terminal region of Human MAS1L. Synthetic peptide located within the following region: WFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETN.
GeneID:
116511
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn