TA331663 POU3F1 / OCT6 antibody

Rabbit Polyclonal Anti-Pou3f1 Antibody

See related secondary antibodies

Search for all "POU3F1 / OCT6"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish POU3F1 / OCT6

Product Description for POU3F1 / OCT6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish POU3F1 / OCT6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POU3F1 / OCT6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms OTF6, Oct-6, Octamer-binding protein 6, Octamer-binding transcription factor 6, POU domain class 3 transcription factor 1, POU domain transcription factor SCIP, SCIP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P20267
Immunogen:
The immunogen for Anti-Pou3f1 Antibody is: synthetic peptide directed towards the C-terminal region of Rat Pou3f1. Synthetic peptide located within the following region: CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDD.
GeneID:
192110
Application WB
Background Pou3f1 may act as a transcriptiol regulator of gene expression during Schwann cell differentiation and myelition.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn