TA331636 FBXO17 antibody

Rabbit Polyclonal Anti-FBXO17 Antibody

See related secondary antibodies

Search for all "FBXO17"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat FBXO17

Product Description for FBXO17

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat FBXO17.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FBXO17

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms F-box only protein 17, F-box only protein 26, FBG4, FBX17, FBX26, FBXO26
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96EF6
Immunogen:
The immunogen for Anti-FBXO17 Antibody is: synthetic peptide directed towards the N-terminal region of Human FBXO17. Synthetic peptide located within the following region: VQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAEGRALYA.
GeneID:
115290
Application WB
Background This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitition. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it contains an F-box domain. Altertive splicing of this gene results in 2 transcript variants encoding different isoforms
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FBXO17 (1 products)

Catalog No. Species Pres. Purity   Source  

FBXO17 (full length, N-term HIS tag, transcript variant 2)

FBXO17 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for FBXO17 (1 products)

Catalog No. Species Pres. Purity   Source  

FBXO17 overexpression lysate

FBXO17 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn