TA331602 REXO1L1P antibody

Rabbit Polyclonal Anti-REXO1L1 Antibody

See related secondary antibodies

Search for all "REXO1L1P"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human REXO1L1P

Product Description for REXO1L1P

Rabbit anti Human REXO1L1P.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for REXO1L1P

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Antigen GOR homolog, GOR, Putative exonuclease GOR, REXO1L1, RNA exonuclease 1 homolog-like 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IX06
Immunogen:
The immunogen for Anti-REXO1L1 Antibody is: synthetic peptide directed towards the middle region of Human REXO1L1. Synthetic peptide located within the following region: ASSSQRSRGSKVGRQPGKTRNRSGMACKTTATTSSKRIVRRASLPSLSLK.
GeneID:
254958
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn