TA331518 Brorin / VWC2 antibody

Rabbit Polyclonal Anti-VWC2 Antibody

See related secondary antibodies

Search for all "Brorin / VWC2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Brorin / VWC2

Product Description for Brorin / VWC2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Brorin / VWC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Brorin / VWC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Brain-specific chordin-like protein, von Willebrand factor C domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2TAL6
Immunogen:
The immunogen for Anti-VWC2 Antibody is: synthetic peptide directed towards the middle region of Human VWC2. Synthetic peptide located within the following region: YVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPR.
GeneID:
375567
Application WB
Background This gene encodes a secreted bone morphogenic protein antagonist. The encoded protein is possibly involved in neural function and development and may have a role in cell adhesion.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn