TA331476 ZNF35 antibody

Rabbit polyclonal Anti-ZNF35 Antibody

See related secondary antibodies

Search for all "ZNF35"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Porcine ZNF35

Product Description for ZNF35

Rabbit anti Human, Porcine ZNF35.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF35

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 35
Presentation Purified
Reactivity Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P13682
Immunogen:
The immunogen for anti-ZNF35 antibody: synthetic peptide directed towards the N terminal of human ZNF35. Synthetic peptide located within the following region: ASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQEA.
GeneID:
7584
Application WB
Background ZNF35 is a new candidate transcription factor
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF35 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF35 (N-term HIS tag)

ZNF35 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.
  • LinkedIn