TA331473 G3BP1 / G3BP antibody

Rabbit polyclonal Anti-G3BP1 Antibody

See related secondary antibodies

Search for all "G3BP1 / G3BP"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat G3BP1 / G3BP

TA331473

More Views

  • TA331473
  • TA331473
  • TA331473

Product Description for G3BP1 / G3BP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat G3BP1 / G3BP.
Presentation: Purified
Product is tested for Immunoprecipitation, Western blot / Immunoblot.

Properties for G3BP1 / G3BP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP-dependent DNA helicase VIII, G3BP-1, GAP SH3 domain-binding protein 1, Ras GTPase-activating protein-binding protein 1, hDH VIII
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications IP, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13283
Immunogen:
The immunogen for anti-G3BP1 antibody: synthetic peptide directed towards the N terminal of human G3BP1. Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP.
GeneID:
10146
Application WB
IP
Background This gene encodes one of the D-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial R/D and R/R duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear R-binding
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for G3BP1 / G3BP (4 products)

Catalog No. Species Pres. Purity   Source  

G3BP1 / G3BP (transcript variant 1)

G3BP1 / G3BP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

G3BP1 / G3BP (transcript variant 2)

G3BP1 / G3BP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

G3BP1 / G3BP (1-466, His-tag)

G3BP1 / G3BP Human Purified > 85 % E. coli
0.25 mg / $1,070.00
  OriGene Technologies GmbH

G3BP1 / G3BP (1-466, His-tag)

G3BP1 / G3BP Human Purified > 85 % E. coli
50 µg / $400.00
  OriGene Technologies GmbH
  • LinkedIn