TA331451 Glypican-3 / GPC3 antibody

Rabbit polyclonal Anti-GPC3 Antibody

See related secondary antibodies

Search for all "Glypican-3 / GPC3"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Glypican-3 / GPC3

TA331451

More Views

  • TA331451

Product Description for Glypican-3 / GPC3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Glypican-3 / GPC3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Glypican-3 / GPC3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GTR2-2, Intestinal protein OCI-5, MXR7, OCI5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P51654
Immunogen:
The immunogen for anti-GPC3 antibody: synthetic peptide directed towards the middle region of human GPC3. Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL.
GeneID:
2719
Application WB
Background Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn