TA331443 FOXK1 / MNF antibody

Rabbit polyclonal Anti-FOXK1 Antibody

See related secondary antibodies

Search for all "FOXK1 / MNF"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Guinea Pig, Mouse, Rat FOXK1 / MNF

TA331443

More Views

  • TA331443

Product Description for FOXK1 / MNF

Rabbit anti Guinea Pig, Mouse, Rat FOXK1 / MNF.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for FOXK1 / MNF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Forkhead box protein K1, Myocyte nuclear factor
Presentation Purified
Reactivity GP, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P42128
Immunogen:
The immunogen for anti-FOXK1 antibody: synthetic peptide directed towards the C terminal of mouse FOXK1. Synthetic peptide located within the following region: VVQQAPTVTMVRVVTTSANSANGYILASQGSTGTSHDTAGTAVLDLGNEA.
GeneID:
17425
Application WB
IHC
Background Foxk1 is a transcriptiol regulator that binds to the upstream enhancer region (CCAC box) of myoglobin gene. It has a role in myogenic differentiation and in remodeling processes of adult muscles that occur in response to physiological stimuli.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn