TA331363 TAAR2 / GPR58 antibody

Rabbit Polyclonal Anti-TAAR2 Antibody

See related secondary antibodies

Search for all "TAAR2 / GPR58"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat TAAR2 / GPR58

Product Description for TAAR2 / GPR58

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat TAAR2 / GPR58.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TAAR2 / GPR58

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-protein coupled receptor 58, Trace amine-associated receptor 2
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P1P5
Immunogen:
The immunogen for Anti-TAAR2 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR2. Synthetic peptide located within the following region: ENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLF.
GeneID:
9287
Application WB
Background TAAR2 is an orphan receptor.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn